BP-TWO-T 30mg Lot 25363 37.85mg
$145.99CAS Number: 2023788-19-2Molecular Formula: C225H348N48O68Molecular Weight: 4,813.5 g/molStructural Sequence: GIP/GLP-1 dual agonist peptidePubChem CID: 16134956ChemSpider ID: 58837766
Showing 17–32 of 81 results
CAS Number: 2023788-19-2Molecular Formula: C225H348N48O68Molecular Weight: 4,813.5 g/molStructural Sequence: GIP/GLP-1 dual agonist peptidePubChem CID: 16134956ChemSpider ID: 58837766
BPC-157 CAS Number: 137525-51-0Molecular Formula: C₆₂H₉₈N₁₆O₂₂Molecular Weight: 1,419.5 g/molStructural Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-ValPubChem CID: 9941957ChemSpider ID: 8112579
CJC-1295 (No DAC) CAS Number: 863288-34-0Molecular Formula: C152H252N44O42Molecular Weight: 3,364 g/molStructural Sequence: Modified GRF(1-29)PubChem CID: 9831698ChemSpider ID: 8007430
Epithalon CAS Number: 307297-39-8Molecular Formula: C14H22N4O9Molecular Weight: 390.35 g/molStructural Sequence: Ala-Glu-Asp-GlyPubChem CID: 219024ChemSpider ID: 189660
GHK-Cu (Copper Tripeptide-1) CAS Number: 89030-95-5Molecular Formula: C₁₄H₂₄N₆O₄CuMolecular Weight: 401.93 g/molStructural Sequence: Gly-His-Lys : Cu²⁺PubChem CID: 918257ChemSpider ID: 797047
2 grams raw Cosmetic Grade GHK-cu Powder. Slight overfill.
Glow (GHK-Cu / BPC-157 / TB-500) CAS: Multiple — component specificFormula: BlendMolecular Weight: Blend dependentSequence: GHK-Cu BPC-157 TB-500 fragment
CAS Number: 910463-68-2Molecular Formula: C187H291N45O59Molecular Weight: 4,113.6 g/molStructural Sequence: GLP-1 analog (modified)PubChem CID: 56843331ChemSpider ID: 58834937
CAS Number: 910463-68-2Molecular Formula: C187H291N45O59Molecular Weight: 4,113.6 g/molStructural Sequence: GLP-1 analog (modified)PubChem CID: 56843331ChemSpider ID: 58834937
CAS Number: 2259884-03-0Molecular Formula: C210H322N46O67Molecular Weight: 4,563.1 g/molStructural Sequence: GLP-1/Glucagon receptor agonist peptidePubChem CID: 167312357ChemSpider ID: 129341158
CAS Number: 1415456-99-3Molecular Formula: C194H312N54O59Molecular Weight: 4,100 g/mol (approx.)Structural Sequence: Amylin analogPubChem CID: 137349840ChemSpider ID: 64834212
The Hydra Stamp is a professional-grade beauty tool designed to help deliver your favorite skincare serums directly to the surface layers of the skin for enhanced absorption. Its ultra-fine titanium tips create micro-channels that work with your skincare routine to support a smooth, refreshed, and hydrated appearance. This easy-to-use device is perfect for incorporating into…
IGF-1 LR3 — Technical Specifications CAS Number:946870-92-4 Molecular Formula:C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₇ Molecular Weight:≈ 9,112.6 g/mol Structural Sequence (Amino Acid Sequence):MFPAMPLLSLFVNASSHQGIVDECCFRSCDLRRLEMYCAPLKPAKSAAGIVQQTPTKTSVEEEKYGPLKPKSA(Synthetic human IGF-1 analog with N-terminal Arg extension and Arg³ substitution) PubChem CID:Not formally assigned (peptide biologic entry varies by salt/registry) ChemSpider ID:Not formally assigned (large recombinant peptide; database entries limited)
Ipamorelin CAS Number: 170851-70-4Molecular Formula: C₃₈H₄₉N₉O₅Molecular Weight: 711.86 g/molStructural Sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH₂PubChem CID: 9831659ChemSpider ID: 8007390
KLOW (KPV / BPC-157 / GHK-Cu / TB-500) CAS: Multiple — component specificFormula: BlendMolecular Weight: Blend dependentSequence: KPV BPC-157 GHK-Cu TB-500 fragment
KPV CAS Number: 67727-97-3Molecular Formula: C16H26N4O4Molecular Weight: 338.4 g/molStructural Sequence: Lys-Pro-ValPubChem CID: 16129661ChemSpider ID: 4470504
All products on this site are for research and development use only. Products are not for human consumption of any kind. The statements made on this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure, or prevent any disease. BioPep Research Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic Act. BioPep Research Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic Act. All products are sold for research, laboratory, or analytical purposes only, and are not for human consumption.